Anti-CD81, Rabbit, Polyclonal

Artikelnummer: ATA-HPA007234
Artikelname: Anti-CD81, Rabbit, Polyclonal
Artikelnummer: ATA-HPA007234
Hersteller Artikelnummer: HPA007234
Alternativnummer: ATA-HPA007234-25,ATA-HPA007234-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: TAPA-1, TAPA1, TSPAN28, Pan-Cancer
CD81 molecule
Anti-CD81
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 975
UniProt: P60033
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VNKDQIAKDVKQFYDQALQQAVVDDDANKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD81
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA007234 antibody. Corresponding CD81 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
Immunohistochemical staining of human prostate shows moderate membranous positivity in glandular cells.
Immunohistochemical staining of human prostate shows weak to moderate membranous positivity in smooth muscle cells.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA007234
HPA007234
HPA007234