Anti-COL3A1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA007583
- Bilder (9)
| Artikelname: | Anti-COL3A1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA007583 |
| Hersteller Artikelnummer: | HPA007583 |
| Alternativnummer: | ATA-HPA007583-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EDS4A |
| collagen, type III, alpha 1 |
| Anti-COL3A1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1281 |
| UniProt: | P02461 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | COL3A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human endometrium shows weak to moderate cytoplasmic positivity in stromal cells. |
|
|
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in fibroblasts. |
|
|
Immunohistochemical staining of human colorectal cancer shows weak to moderate cytoplasmic positivity in stromal cells. |
|
|
Immunohistochemical staining of human pancreas shows very weak positivity in exocrine glandular cells as expected. |
|
|
Western blot analysis in human cell lines HeLa and SK-MEL-30 using Anti-COL3A1 antibody. Corresponding COL3A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
|
|
|
HPA007583 |
|
|
HPA007583 |
|
|
HPA007583 |
Produktgarantie und fachkundiger Support
