Anti-ABCA3, Rabbit, Polyclonal

Artikelnummer: ATA-HPA007884
Artikelname: Anti-ABCA3, Rabbit, Polyclonal
Artikelnummer: ATA-HPA007884
Hersteller Artikelnummer: HPA007884
Alternativnummer: ATA-HPA007884-25,ATA-HPA007884-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ABC-C, ABC3, EST111653, LBM180
ATP-binding cassette, sub-family A (ABC1), member 3
Anti-ABCA3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 21
UniProt: Q99758
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCLVAASFRDVGERTVVLFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ABCA3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line HUVEC TERT2 shows localization to nucleoplasm & cytosol.
Immunohistochemistry analysis in human lung and liver tissues using HPA007884 antibody. Corresponding ABCA3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lung shows strong positivity in pneumocytes.
Immunohistochemical staining of human cerebellum shows positivity in Purkinje cells.
Immunohistochemical staining of human liver shows weak cytoplasmic positivity in hepatocytes.
HPA007884
HPA007884
HPA007884