Anti-GM2A, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA008063
- Bilder (9)
| Artikelname: | Anti-GM2A, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA008063 |
| Hersteller Artikelnummer: | HPA008063 |
| Alternativnummer: | ATA-HPA008063-25,ATA-HPA008063-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SAP-3 |
| GM2 ganglioside activator |
| Anti-GM2A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2760 |
| UniProt: | P17900 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GM2A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-GM2A antibody. Corresponding GM2A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human skin shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Western blot analysis in human cell lines SK-MEL-30 and MCF-7 using Anti-GM2A antibody. Corresponding GM2A RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA008063 |
|
|
|
|
|
HPA008063 |
|
|
HPA008063 |
Produktgarantie und fachkundiger Support
