Anti-RET, Rabbit, Polyclonal

Artikelnummer: ATA-HPA008356
Artikelname: Anti-RET, Rabbit, Polyclonal
Artikelnummer: ATA-HPA008356
Hersteller Artikelnummer: HPA008356
Alternativnummer: ATA-HPA008356-25,ATA-HPA008356-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CDHF12, CDHR16, HSCR1, MEN2A, MEN2B, MTC1, PTC, RET51, Pan-Cancer
ret proto-oncogene
Anti-RET
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 5979
UniProt: P07949
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKESPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RET
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & vesicles.
Immunohistochemical staining of human gastrointestinal shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human adrenal gland shows strong membranous positivity in glandular cells.
Immunohistochemical staining of human cerebellum shows strong membranous positivity in Purkinje cells.
Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells.
HPA008356
HPA008356
HPA008356