Anti-RET, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA008356
Artikelname: |
Anti-RET, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA008356 |
Hersteller Artikelnummer: |
HPA008356 |
Alternativnummer: |
ATA-HPA008356-25,ATA-HPA008356-100 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ICC, IHC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
CDHF12, CDHR16, HSCR1, MEN2A, MEN2B, MTC1, PTC, RET51, Pan-Cancer |
Klonalität: |
Polyclonal |
Konzentration: |
0.3 mg/ml |
Isotyp: |
IgG |
NCBI: |
5979 |
UniProt: |
P07949 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKESPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
RET |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & vesicles. |
|
Immunohistochemical staining of human gastrointestinal shows strong membranous positivity in glandular cells. |
|
Immunohistochemical staining of human adrenal gland shows strong membranous positivity in glandular cells. |
|
Immunohistochemical staining of human cerebellum shows strong membranous positivity in Purkinje cells. |
|
Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells. |
|
HPA008356 |
|
|
|
HPA008356 |
|
HPA008356 |