Anti-NME1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA008467
- Bilder (9)
| Artikelname: | Anti-NME1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA008467 |
| Hersteller Artikelnummer: | HPA008467 |
| Alternativnummer: | ATA-HPA008467-25,ATA-HPA008467-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | NDPKA, NM23, NM23-H1 |
| NME/NM23 nucleoside diphosphate kinase 1 |
| Anti-NME1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4830 |
| UniProt: | P15531 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NME1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol. |
|
|
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells. |
|
|
Western blot analysis in human cell line A-549. |
|
|
Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12. |
|
|
HPA008467 |
|
|
|
|
|
|
|
|
HPA008467 |
|
|
HPA008467 |
Produktgarantie und fachkundiger Support
