Anti-MUC1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA008855
Artikelname: Anti-MUC1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA008855
Hersteller Artikelnummer: HPA008855
Alternativnummer: ATA-HPA008855-25,ATA-HPA008855-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ADMCKD, ADMCKD1, CD227, MCD, MCKD, MCKD1, PEM, PUM, Pan-Cancer
mucin 1, cell surface associated
Anti-MUC1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4582
UniProt: P15941
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MUC1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human stomach and liver tissues using Anti-MUC1 antibody. Corresponding MUC1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human stomach shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA008855
HPA008855
HPA008855