Anti-COL12A1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA009143
- Bilder (9)
| Artikelname: | Anti-COL12A1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA009143 |
| Hersteller Artikelnummer: | HPA009143 |
| Alternativnummer: | ATA-HPA009143-25,ATA-HPA009143-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | COL12A1L |
| collagen, type XII, alpha 1 |
| Anti-COL12A1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1303 |
| UniProt: | Q99715 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | COL12A1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human endometrium shows strong positivity in basement membranes. |
|
|
Immunohistochemical staining of human liver shows very weak cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human testis shows strong membranous positivity in peritubular myoid cells. |
|
|
Western blot analysis in human cell lines U2OS and A-431 using Anti-COL12A1 antibody. Corresponding COL12A1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1. |
|
|
HPA009143 |
|
|
|
|
|
HPA009143 |
|
|
HPA009143 |
Produktgarantie und fachkundiger Support
