Anti-CD276, Rabbit, Polyclonal

Artikelnummer: ATA-HPA009285
Artikelname: Anti-CD276, Rabbit, Polyclonal
Artikelnummer: ATA-HPA009285
Hersteller Artikelnummer: HPA009285
Alternativnummer: ATA-HPA009285-25,ATA-HPA009285-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: B7-H3, B7H3, B7RP-2
CD276 molecule
Anti-CD276
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 80381
UniProt: Q5ZPR3
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD276
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human prostate and pancreas tissues using Anti-CD276 antibody. Corresponding CD276 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human prostate shows high expression.
Western blot analysis in human cell line HEK 293.
Western blot analysis in control (vector only transfected HEK293T lysate) and CD276 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410803).
HPA009285
HPA009285
HPA009285