Anti-NDFIP1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA009682
- Bilder (9)
| Artikelname: | Anti-NDFIP1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA009682 |
| Hersteller Artikelnummer: | HPA009682 |
| Alternativnummer: | ATA-HPA009682-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC10924, N4WBP5 |
| Nedd4 family interacting protein 1 |
| Anti-NDFIP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 80762 |
| UniProt: | Q9BT67 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NDFIP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human kidney shows strong granular positivity in cytoplasm in cells in tubules. |
|
|
Immunohistochemical staining of human testis shows moderate granular cytoplasmic positivity in Leydig cells. |
|
|
Western blot analysis in human cell line RPMI-8226. |
|
|
HPA009682 |
|
|
|
|
|
HPA009682 |
|
|
HPA009682 |
Produktgarantie und fachkundiger Support
