Anti-RMDN3, Rabbit, Polyclonal

Artikelnummer: ATA-HPA009975
Artikelname: Anti-RMDN3, Rabbit, Polyclonal
Artikelnummer: ATA-HPA009975
Hersteller Artikelnummer: HPA009975
Alternativnummer: ATA-HPA009975-25,ATA-HPA009975-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FAM82A2, FAM82C, FLJ10579, PTPIP51, RMD3
regulator of microtubule dynamics 3
Anti-RMDN3
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 55177
UniProt: Q96TC7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCHLWYAVLCG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RMDN3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemical staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.
Western blot analysis in human cell line CACO-2.
HPA009975
HPA009975
HPA009975