Anti-CD63, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA010088
- Bilder (7)
| Artikelname: | Anti-CD63, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA010088 |
| Hersteller Artikelnummer: | HPA010088 |
| Alternativnummer: | ATA-HPA010088-25,ATA-HPA010088-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ME491, MLA1, TSPAN30, Pan-Cancer |
| CD63 molecule |
| Anti-CD63 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 967 |
| UniProt: | P08962 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD63 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in macrophages. |
|
|
Immunohistochemical staining of human duodenum shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human bone marrow shows moderate to strong cytoplasmic positivity in hematopoietic cells. |
|
|
HPA010088 |
|
|
HPA010088 |
|
|
HPA010088 |
Produktgarantie und fachkundiger Support
