Anti-CD74, Rabbit, Polyclonal

Artikelnummer: ATA-HPA010592
Artikelname: Anti-CD74, Rabbit, Polyclonal
Artikelnummer: ATA-HPA010592
Hersteller Artikelnummer: HPA010592
Alternativnummer: ATA-HPA010592-25,ATA-HPA010592-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DHLAG
CD74 molecule, major histocompatibility complex, class II invariant chain
Anti-CD74
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 972
UniProt: P04233
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PKPVSKMRMATPLLMQALPMGALPQGPMQTKYGNMTEDHVMHLLQDPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD74
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human tonsil shows strong membranous and cytoplasmic positivity in germinal center cells and in non-germinal center cells.
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in microglia.
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.
Western blot analysis in human cell line Daudi.
HPA010592
HPA010592
HPA010592