Anti-AFP, Rabbit, Polyclonal

Artikelnummer: ATA-HPA010607
Artikelname: Anti-AFP, Rabbit, Polyclonal
Artikelnummer: ATA-HPA010607
Hersteller Artikelnummer: HPA010607
Alternativnummer: ATA-HPA010607-25,ATA-HPA010607-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FETA, HPAFP, Pan-Cancer
alpha-fetoprotein
Anti-AFP
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 174
UniProt: P02771
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: FAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAAR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: AFP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human placenta shows extra cellular positivity.
Western blot analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-AFP antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western blot analysis in control (vector only transfected HEK293T lysate) and AFP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400455).
HPA010607
HPA010607
HPA010607