Anti-ALK, Rabbit, Polyclonal

Artikelnummer: ATA-HPA010694
Artikelname: Anti-ALK, Rabbit, Polyclonal
Artikelnummer: ATA-HPA010694
Hersteller Artikelnummer: HPA010694
Alternativnummer: ATA-HPA010694-25,ATA-HPA010694-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD246, Pan-Cancer
anaplastic lymphoma receptor tyrosine kinase
Anti-ALK
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 238
UniProt: Q9UM73
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ALK
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50
Immunofluorescent staining of human cell line RH-30 shows localization to plasma membrane.
Immunohistochemical staining of human cerebral cortex shows cytoplasmic positivity in neurons.
HPA010694
HPA010694