Anti-ADAM17, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA010738
Artikelname: |
Anti-ADAM17, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA010738 |
Hersteller Artikelnummer: |
HPA010738 |
Alternativnummer: |
ATA-HPA010738-25,ATA-HPA010738-100 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ICC, IHC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
CD156B, cSVP, TACE, Pan-Cancer |
ADAM metallopeptidase domain 17 |
Klonalität: |
Polyclonal |
Konzentration: |
0.1 mg/ml |
Isotyp: |
IgG |
NCBI: |
6868 |
UniProt: |
P78536 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
ADAM17 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm. |
|
Immunohistochemical staining of human small intestine shows membranous and cytoplasmic positivity. |
|
HPA010738 |
|
|
|
HPA010738 |
|
HPA010738 |