Anti-ADAM17, Rabbit, Polyclonal

Artikelnummer: ATA-HPA010738
Artikelname: Anti-ADAM17, Rabbit, Polyclonal
Artikelnummer: ATA-HPA010738
Hersteller Artikelnummer: HPA010738
Alternativnummer: ATA-HPA010738-25,ATA-HPA010738-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD156B, cSVP, TACE, Pan-Cancer
ADAM metallopeptidase domain 17
Anti-ADAM17
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 6868
UniProt: P78536
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ADAM17
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemical staining of human small intestine shows membranous and cytoplasmic positivity.
HPA010738
HPA010738
HPA010738