Anti-ANXA1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA011272
- Bilder (17)
| Artikelname: | Anti-ANXA1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA011272 |
| Hersteller Artikelnummer: | HPA011272 |
| Alternativnummer: | ATA-HPA011272-25,ATA-HPA011272-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ANX1, LPC1, Pan-Cancer |
| annexin A1 |
| Anti-ANXA1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 301 |
| UniProt: | P04083 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILTKRNQRQQIKAAYLQETGKPLDETLKKALTG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ANXA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemistry analysis in human esophagus and cerebral cortex tissues using HPA011272 antibody. Corresponding ANXA1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, esophagus and liver using Anti-ANXA1 antibody HPA011272 (A) shows similar protein distribution across tissues to independent antibody HPA011271 (B). |
|
|
Immunohistochemical staining of human lung shows strong positivity in macrophages. |
|
|
Immunohistochemical staining of human lymph node shows moderate positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human colon shows strong positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human esophagus shows strong positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected. |
|
|
Immunohistochemical staining of human liver using Anti-ANXA1 antibody HPA011272. |
|
|
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ANXA1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis using Anti-ANXA1 antibody HPA011272 (A) shows similar pattern to independent antibody HPA011271 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA011272 |
|
|
|
|
|
|
|
|
HPA011272 |
|
|
HPA011272 |
Produktgarantie und fachkundiger Support
