Anti-ENG, Rabbit, Polyclonal

Artikelnummer: ATA-HPA011862
Artikelname: Anti-ENG, Rabbit, Polyclonal
Artikelnummer: ATA-HPA011862
Hersteller Artikelnummer: HPA011862
Alternativnummer: ATA-HPA011862-25,ATA-HPA011862-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD105, END, HHT1, ORW, ORW1, Pan-Cancer
endoglin
Anti-ENG
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 2022
UniProt: P17813
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ENG
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Western blot analysis in human cell line U-138 MG.
HPA011862
HPA011862