Anti-ADAP1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA012049
- Bilder (9)
| Artikelname: | Anti-ADAP1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA012049 |
| Hersteller Artikelnummer: | HPA012049 |
| Alternativnummer: | ATA-HPA012049-25,ATA-HPA012049-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CENTA1, GCS1L |
| ArfGAP with dual PH domains 1 |
| Anti-ADAP1 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 11033 |
| UniProt: | O75689 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LGVFICLSCSGIHRNIPQVSKVKSVRLDAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEPYSAGYREGFLWKRG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ADAP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using Anti-ADAP1 antibody. Corresponding ADAP1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, hippocampus, ovary and tonsil using Anti-ADAP1 antibody HPA012049 (A) shows similar protein distribution across tissues to independent antibody HPA007033 (B). |
|
|
Immunohistochemical staining of human tonsil shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human ovary using Anti-ADAP1 antibody HPA012049. |
|
|
Immunohistochemical staining of human hippocampus using Anti-ADAP1 antibody HPA012049. |
|
|
HPA012049 |
|
|
HPA012049 |
|
|
HPA012049 |
Produktgarantie und fachkundiger Support
