Anti-APC, Rabbit, Polyclonal

Artikelnummer: ATA-HPA013349
Artikelname: Anti-APC, Rabbit, Polyclonal
Artikelnummer: ATA-HPA013349
Hersteller Artikelnummer: HPA013349
Alternativnummer: ATA-HPA013349-25,ATA-HPA013349-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DP2, DP2.5, DP3, PPP1R46, Pan-Cancer
adenomatous polyposis coli
Anti-APC
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 324
UniProt: P25054
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: APC
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human small intestine shows moderate to strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemical staining of human skeletal muscle shows low positivity in myocytes as expected.
Immunohistochemical staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.
HPA013349
HPA013349
HPA013349