Anti-MS4A1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA014391
Artikelname: Anti-MS4A1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA014391
Hersteller Artikelnummer: HPA014391
Alternativnummer: ATA-HPA014391-25,ATA-HPA014391-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: B1, Bp35, CD20, MS4A2, Pan-Cancer
membrane-spanning 4-domains, subfamily A, member 1
Anti-MS4A1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 931
UniProt: P11836
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MS4A1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human tonsil and cerebral cortex tissues using Anti-MS4A1 antibody. Corresponding MS4A1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, lymph node, spleen and testis using Anti-MS4A1 antibody HPA014391 (A) shows similar protein distribution across tissues to independent antibody HPA014341 (B).
Immunohistochemical staining of human cerebral cortex shows low expression as expected.
Immunohistochemical staining of human tonsil shows high expression.
Immunohistochemical staining of human spleen using Anti-MS4A1 antibody HPA014391.
Immunohistochemical staining of human testis using Anti-MS4A1 antibody HPA014391.
Immunohistochemical staining of human lymph node using Anti-MS4A1 antibody HPA014391.
HPA014391
HPA014391
HPA014391