Anti-SIGMAR1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA018002
- Bilder (9)
| Artikelname: | Anti-SIGMAR1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA018002 |
| Hersteller Artikelnummer: | HPA018002 |
| Alternativnummer: | ATA-HPA018002-25,ATA-HPA018002-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | OPRS1, SR-BP1 |
| sigma non-opioid intracellular receptor 1 |
| Anti-SIGMAR1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10280 |
| UniProt: | Q99720 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVGG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SIGMAR1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human Fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
Immunohistochemical staining of human gastrointestinal shows moderate cytoplasmic and membranous positivity in glandular cells. |
|
|
Western blot analysis in human cell lines PC-3 and MCF-7 using Anti-SIGMAR1 antibody. Corresponding SIGMAR1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB. |
|
|
HPA018002 |
|
|
|
|
|
HPA018002 |
|
|
HPA018002 |
Produktgarantie und fachkundiger Support
