Anti-LRP1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA022903
Artikelname: Anti-LRP1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA022903
Hersteller Artikelnummer: HPA022903
Alternativnummer: ATA-HPA022903-25,ATA-HPA022903-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: A2MR, APR, CD91, LRP, Pan-Cancer
low density lipoprotein receptor-related protein 1
Anti-LRP1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 4035
UniProt: Q07954
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LRP1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human placenta and pancreas tissues using HPA022903 antibody. Corresponding LRP1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells.
Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in stromal cells.
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Western blot analysis in human cell line RH-30.
HPA022903
HPA022903
HPA022903