Anti-FN1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA027066
Artikelname: Anti-FN1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA027066
Hersteller Artikelnummer: HPA027066
Alternativnummer: ATA-HPA027066-25,ATA-HPA027066-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CIG, FINC, GFND2, LETS, MSF, Pan-Cancer
fibronectin 1
Anti-FN1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 2335
UniProt: P02751
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FN1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human placenta and pancreas tissues using HPA027066 antibody. Corresponding FN1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows strong positivity in plasma.
Immunohistochemical staining of human skin shows moderate positivity in dermis.
Immunohistochemical staining of human pancreas shows low positivity in exocrine glandular cells as expected.
Immunohistochemical staining of human placenta shows very strong positivity in plasma.
Western blot analysis in human plasma.
HPA027066
HPA027066
HPA027066