Anti-FAS, Rabbit, Polyclonal

Artikelnummer: ATA-HPA027444
Artikelname: Anti-FAS, Rabbit, Polyclonal
Artikelnummer: ATA-HPA027444
Hersteller Artikelnummer: HPA027444
Alternativnummer: ATA-HPA027444-25,ATA-HPA027444-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: APO-1, APT1, CD95, FAS1, TNFRSF6, Pan-Cancer
Fas cell surface death receptor
Anti-FAS
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 355
UniProt: P25445
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FAS
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to nuclear bodies, plasma membrane & cytosol.
Immunohistochemistry analysis in human rectum and skeletal muscle tissues using Anti-FAS antibody. Corresponding FAS RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human rectum shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in human cell line HDLM-2.
HPA027444
HPA027444
HPA027444