Anti-ITGB3, Rabbit, Polyclonal

Artikelnummer: ATA-HPA027852
Artikelname: Anti-ITGB3, Rabbit, Polyclonal
Artikelnummer: ATA-HPA027852
Hersteller Artikelnummer: HPA027852
Alternativnummer: ATA-HPA027852-25,ATA-HPA027852-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD61, GP3A, GPIIIa, Pan-Cancer
integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
Anti-ITGB3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 3690
UniProt: P05106
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VRDLPEELSLSFTCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ITGB3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes.
HPA027852