Anti-BAD, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA028185
- Bilder (7)
| Artikelname: | Anti-BAD, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA028185 |
| Hersteller Artikelnummer: | HPA028185 |
| Alternativnummer: | ATA-HPA028185-25,ATA-HPA028185-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BBC2, BCL2L8, Pan-Cancer |
| BCL2-associated agonist of cell death |
| Anti-BAD |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 572 |
| UniProt: | Q92934 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BAD |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to mitochondria. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of tubules. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA028185 |
|
|
|
|
|
HPA028185 |
|
|
HPA028185 |
Produktgarantie und fachkundiger Support
