Anti-E2F1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA029735
Artikelname: Anti-E2F1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA029735
Hersteller Artikelnummer: HPA029735
Alternativnummer: ATA-HPA029735-25,ATA-HPA029735-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: RBBP3, RBP3, Pan-Cancer
E2F transcription factor 1
Anti-E2F1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 1869
UniProt: Q01094
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: E2F1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line RH-30 shows localization to centrosome.
Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
HPA029735
HPA029735