Anti-BMI1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA030471
| Artikelname: |
Anti-BMI1, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA030471 |
| Hersteller Artikelnummer: |
HPA030471 |
| Alternativnummer: |
ATA-HPA030471-25,ATA-HPA030471-100 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ICC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
PCGF4, RNF51, Pan-Cancer |
| BMI1 proto-oncogene, polycomb ring finger |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.05 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
648 |
| UniProt: |
P35226 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
SLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYE |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
BMI1 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml |
![]()
|
Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear bodies. |
![]()
|
HPA030471 |
