Anti-SRC, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA030875
- Bilder (5)
| Artikelname: | Anti-SRC, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA030875 |
| Hersteller Artikelnummer: | HPA030875 |
| Alternativnummer: | ATA-HPA030875-25,ATA-HPA030875-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ASV, c-src, SRC1, Pan-Cancer |
| SRC proto-oncogene, non-receptor tyrosine kinase |
| Anti-SRC |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 6714 |
| UniProt: | P12931 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPAS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SRC |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human testis shows membranous and cytoplasmic positivity in cells in seminferous ducts. |
|
|
Western blot analysis in human cell lines A-549 and HeLa using Anti-SRC antibody. Corresponding SRC RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
HPA030875 |
|
|
HPA030875 |
Produktgarantie und fachkundiger Support
