Anti-ITGA2B, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031171
Artikelname: Anti-ITGA2B, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031171
Hersteller Artikelnummer: HPA031171
Alternativnummer: ATA-HPA031171-25,ATA-HPA031171-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD41, CD41B, GP2B, PPP1R93, Pan-Cancer
integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41)
Anti-ITGA2B
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 3674
UniProt: P08514
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: FGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ITGA2B
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human bone marrow and stomach tissues using Anti-ITGA2B antibody. Corresponding ITGA2B RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human bone marrow, colon, liver and lymph node using Anti-ITGA2B antibody HPA031171 (A) shows similar protein distribution across tissues to independent antibody HPA031168 (B).
Immunohistochemical staining of human bone marrow shows high expression.
Immunohistochemical staining of human stomach shows low expression as expected.
Immunohistochemical staining of human colon using Anti-ITGA2B antibody HPA031171.
Immunohistochemical staining of human liver using Anti-ITGA2B antibody HPA031171.
Immunohistochemical staining of human lymph node using Anti-ITGA2B antibody HPA031171.
HPA031171
HPA031171
HPA031171