Anti-EPAS1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031200
Artikelname: Anti-EPAS1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031200
Hersteller Artikelnummer: HPA031200
Alternativnummer: ATA-HPA031200-25,ATA-HPA031200-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bHLHe73, HIF2A, HLF, MOP2, PASD2, Pan-Cancer
endothelial PAS domain protein 1
Anti-EPAS1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 2034
UniProt: Q99814
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: EPAS1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm & cytosol.
HPA031200