Anti-EPAS1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA031200
Artikelname: |
Anti-EPAS1, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA031200 |
Hersteller Artikelnummer: |
HPA031200 |
Alternativnummer: |
ATA-HPA031200-25,ATA-HPA031200-100 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ICC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
bHLHe73, HIF2A, HLF, MOP2, PASD2, Pan-Cancer |
endothelial PAS domain protein 1 |
Klonalität: |
Polyclonal |
Konzentration: |
0.2 mg/ml |
Isotyp: |
IgG |
NCBI: |
2034 |
UniProt: |
Q99814 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
EPAS1 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml |
|
Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm & cytosol. |
|
HPA031200 |