Anti-PTEN, Rabbit, Polyclonal

Artikelnummer: ATA-HPA031335
Artikelname: Anti-PTEN, Rabbit, Polyclonal
Artikelnummer: ATA-HPA031335
Hersteller Artikelnummer: HPA031335
Alternativnummer: ATA-HPA031335-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BZS, MHAM, MMAC1, PTEN1, TEP1, Pan-Cancer
phosphatase and tensin homolog
Anti-PTEN
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 5728
UniProt: P60484
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PTEN
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Western blot analysis in human cell line A-431.
HPA031335
HPA031335
HPA031335