Anti-CD40, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA031567
- Bilder (11)
| Artikelname: | Anti-CD40, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA031567 |
| Hersteller Artikelnummer: | HPA031567 |
| Alternativnummer: | ATA-HPA031567-25,ATA-HPA031567-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Bp50, p50, TNFRSF5, Pan-Cancer |
| CD40 molecule, TNF receptor superfamily member 5 |
| Anti-CD40 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 958 |
| UniProt: | P25942 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD40 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human lymph node and cerebral cortex tissues using Anti-CD40 antibody. Corresponding CD40 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human appendix, spleen, testis and tonsil using Anti-CD40 antibody HPA031567 (A) shows similar protein distribution across tissues to independent antibody HPA031568 (B). |
|
|
Immunohistochemical staining of human cerebral cortex shows low expression as expected. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human appendix using Anti-CD40 antibody HPA031567. |
|
|
Immunohistochemical staining of human tonsil using Anti-CD40 antibody HPA031567. |
|
|
Immunohistochemical staining of human spleen using Anti-CD40 antibody HPA031567. |
|
|
Immunohistochemical staining of human testis using Anti-CD40 antibody HPA031567. |
|
|
HPA031567 |
|
|
HPA031567 |
|
|
HPA031567 |
Produktgarantie und fachkundiger Support
