Anti-GJA1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA035097
Artikelname: Anti-GJA1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA035097
Hersteller Artikelnummer: HPA035097
Alternativnummer: ATA-HPA035097-25,ATA-HPA035097-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CX43, GJAL, ODD, ODDD, ODOD, SDTY3, Pan-Cancer
gap junction protein, alpha 1, 43kDa
Anti-GJA1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 2697
UniProt: P17302
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GJA1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human parathyroid gland and liver tissues using Anti-GJA1 antibody. Corresponding GJA1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human parathyroid gland shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
HPA035097
HPA035097
HPA035097