Anti-SLC35A2 Antibody 100ul, Unconjugated, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-SLC35A2 Antibody 100ul, Unconjugated, Rabbit, Polyclonal
• Artikelnummer: ATA-HPA036087
• Hersteller Artikelnummer: HPA036087
• Alternativnummer: ATA-HPA036087-100, ATA-HPA036087-25
• Hersteller: Atlas Antibodies
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ICC, IHC
• Spezies Reaktivität: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Konjugation: Unconjugated
• Alternative Synonym: UGALT, UGAT, UGT, UGT1, UGT2, UGTL

Produkteigenschaften

• Klonalität: Polyclonal
• NCBI: 7355
• UniProt: P78381
• Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Reinheit: Affinity purified using the PrEST antigen as affinity ligand
• Sequenz: RGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS
• Target-Kategorie: SLC35A2