Anti-CD34, Rabbit, Polyclonal

Artikelnummer: ATA-HPA036723
Artikelname: Anti-CD34, Rabbit, Polyclonal
Artikelnummer: ATA-HPA036723
Hersteller Artikelnummer: HPA036723
Alternativnummer: ATA-HPA036723-25,ATA-HPA036723-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Pan-Cancer
CD34 molecule
Anti-CD34
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 947
UniProt: P28906
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD34
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line HUVEC TERT2 shows localization to nucleoplasm & cell junctions.
Immunohistochemistry analysis in human placenta and cerebral cortex tissues using HPA036723 antibody. Corresponding CD34 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human lymphoid tissues shows moderate to strong membranous positivity in endothelial cells.
Immunohistochemical staining of human kidney shows moderate membranous positivity in endothelial cells.
Immunohistochemical staining of human cerebral cortex shows moderate membranous positivity in endothelial cells and very weak cytoplasmic positivity in neurons.
Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in endothelial cells.
HPA036723
HPA036723
HPA036723