Anti-AXL, Rabbit, Polyclonal

Artikelnummer: ATA-HPA037422
Artikelname: Anti-AXL, Rabbit, Polyclonal
Artikelnummer: ATA-HPA037422
Hersteller Artikelnummer: HPA037422
Alternativnummer: ATA-HPA037422-25,ATA-HPA037422-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: JTK11, UFO, Pan-Cancer
AXL receptor tyrosine kinase
Anti-AXL
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 558
UniProt: P30530
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: AXL
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western blot analysis in control (vector only transfected HEK293T lysate) and AXL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411883).
HPA037422
HPA037422
HPA037422