Anti-AURKB, Rabbit, Polyclonal

Artikelnummer: ATA-HPA037708
Artikelname: Anti-AURKB, Rabbit, Polyclonal
Artikelnummer: ATA-HPA037708
Hersteller Artikelnummer: HPA037708
Alternativnummer: ATA-HPA037708-25,ATA-HPA037708-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: Aik2, AIM-1, ARK2, AurB, IPL1, PPP1R48, STK12, STK5, Pan-Cancer
aurora kinase B
Anti-AURKB
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 9212
UniProt: Q96GD4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: AURKB
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & midbody.
HPA037708