Anti-GAPDH, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA040067
- Bilder (9)
| Artikelname: | Anti-GAPDH, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA040067 |
| Hersteller Artikelnummer: | HPA040067 |
| Alternativnummer: | ATA-HPA040067-25,ATA-HPA040067-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GAPD, Pan-Cancer |
| glyceraldehyde-3-phosphate dehydrogenase |
| Anti-GAPDH |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2597 |
| UniProt: | P04406 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GAPDH |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human stomach, lower shows strong nuclear and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GAPDH antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB. |
|
|
Western blot analysis using Anti-GAPDH antibody HPA040067 (A) shows similar pattern to independent antibody HPA061280 (B). |
|
|
|
|
|
|
|
|
HPA040067 |
|
|
HPA040067 |
|
|
HPA040067 |
Produktgarantie und fachkundiger Support
