Anti-PRNP, Rabbit, Polyclonal

Artikelnummer: ATA-HPA042754
Artikelname: Anti-PRNP, Rabbit, Polyclonal
Artikelnummer: ATA-HPA042754
Hersteller Artikelnummer: HPA042754
Alternativnummer: ATA-HPA042754-25,ATA-HPA042754-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: AltPrP, CD230, CJD, GSS, PRIP, PRP, Pan-Cancer
prion protein
Anti-PRNP
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5621
UniProt: P04156
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PRNP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA042754 antibody. Corresponding PRNP RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in keratinocytes.
Immunohistochemical staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
HPA042754
HPA042754
HPA042754