Anti-ADAMTS13, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA042844
| Artikelname: |
Anti-ADAMTS13, Rabbit, Polyclonal |
| Artikelnummer: |
ATA-HPA042844 |
| Hersteller Artikelnummer: |
HPA042844 |
| Alternativnummer: |
ATA-HPA042844-25,ATA-HPA042844-100 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
C9orf8, DKFZp434C2322, FLJ42993, MGC118899, MGC118900, TTP, vWF-CP, VWFCP |
| ADAM metallopeptidase with thrombospondin type 1 motif, 13 |
| Klonalität: |
Polyclonal |
| Isotyp: |
IgG |
| NCBI: |
11093 |
| UniProt: |
Q76LX8 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
AHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSSLLSVCGWSQTINPEDDTDPGHADLVLYITRFDLELPDGNRQV |
| Target-Kategorie: |
ADAMTS13 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:20 - 1:50 |
![]()
|
HPA042844 |
