Anti-ERBB3, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA045396
- Bilder (4)
Artikelname: | Anti-ERBB3, Rabbit, Polyclonal |
Artikelnummer: | ATA-HPA045396 |
Hersteller Artikelnummer: | HPA045396 |
Alternativnummer: | ATA-HPA045396-25,ATA-HPA045396-100 |
Hersteller: | Atlas Antibodies |
Wirt: | Rabbit |
Kategorie: | Antikörper |
Applikation: | IHC, WB |
Spezies Reaktivität: | Human |
Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: | Unconjugated |
Alternative Synonym: | HER3, LCCS2, Pan-Cancer |
v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3 |
Anti-ERBB3 |
Klonalität: | Polyclonal |
Konzentration: | 0.1 mg/ml |
Isotyp: | IgG |
NCBI: | 2065 |
UniProt: | P21860 |
Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: | LATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCR |
Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: | ERBB3 |
Antibody Type: | Monoclonal Antibody |
Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |