Anti-ERBB3, Rabbit, Polyclonal

Artikelnummer: ATA-HPA045396
Artikelname: Anti-ERBB3, Rabbit, Polyclonal
Artikelnummer: ATA-HPA045396
Hersteller Artikelnummer: HPA045396
Alternativnummer: ATA-HPA045396-25,ATA-HPA045396-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HER3, LCCS2, Pan-Cancer
v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
Anti-ERBB3
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 2065
UniProt: P21860
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ERBB3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.
Western blot analysis in human cell line SK-MEL-30.
HPA045396
HPA045396