Anti-CDX2, Rabbit, Polyclonal

Artikelnummer: ATA-HPA045669
Artikelname: Anti-CDX2, Rabbit, Polyclonal
Artikelnummer: ATA-HPA045669
Hersteller Artikelnummer: HPA045669
Alternativnummer: ATA-HPA045669-25,ATA-HPA045669-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CDX3, Pan-Cancer
caudal type homeobox 2
Anti-CDX2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 1045
UniProt: Q99626
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CDX2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm.
HPA045669