Anti-PTH, Rabbit, Polyclonal

Artikelnummer: ATA-HPA048540
Artikelname: Anti-PTH, Rabbit, Polyclonal
Artikelnummer: ATA-HPA048540
Hersteller Artikelnummer: HPA048540
Alternativnummer: ATA-HPA048540-25,ATA-HPA048540-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PTH1, Pan-Cancer
parathyroid hormone
Anti-PTH
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 5741
UniProt: P01270
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PTH
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500
Immunohistochemistry analysis in human parathyroid gland and cervix, uterine tissues using Anti-PTH antibody. Corresponding PTH RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human parathyroid gland shows high expression.
Immunohistochemical staining of human cervix, uterine shows low expression as expected.
HPA048540
HPA048540
HPA048540