Anti-TLR4, Rabbit, Polyclonal

Artikelnummer: ATA-HPA049174
Artikelname: Anti-TLR4, Rabbit, Polyclonal
Artikelnummer: ATA-HPA049174
Hersteller Artikelnummer: HPA049174
Alternativnummer: ATA-HPA049174-25,ATA-HPA049174-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ARMD10, CD284, hToll, TLR-4, Pan-Cancer
toll-like receptor 4
Anti-TLR4
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 7099
UniProt: O00206
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TLR4
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human spleen shows distinct cytoplasmic positivity in subsets of cells in the red pulp.
HPA049174
HPA049174
HPA049174