Anti-SERPINE1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA050039
Artikelname: Anti-SERPINE1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA050039
Hersteller Artikelnummer: HPA050039
Alternativnummer: ATA-HPA050039-25,ATA-HPA050039-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PAI, PAI1, PLANH1, Pan-Cancer
serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1
Anti-SERPINE1
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 5054
UniProt: P05121
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SERPINE1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in a subset of squamous epithelial cells.
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in endothelial cells.
Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic positivity in a subset of urothelial cells.
Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in endothelial cells.
HPA050039
HPA050039
HPA050039