Anti-SERPINE1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA050039
Artikelname: |
Anti-SERPINE1, Rabbit, Polyclonal |
Artikelnummer: |
ATA-HPA050039 |
Hersteller Artikelnummer: |
HPA050039 |
Alternativnummer: |
ATA-HPA050039-25,ATA-HPA050039-100 |
Hersteller: |
Atlas Antibodies |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ICC, IHC |
Spezies Reaktivität: |
Human |
Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: |
Unconjugated |
Alternative Synonym: |
PAI, PAI1, PLANH1, Pan-Cancer |
serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 |
Klonalität: |
Polyclonal |
Konzentration: |
0.05 mg/ml |
Isotyp: |
IgG |
NCBI: |
5054 |
UniProt: |
P05121 |
Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: |
RLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADF |
Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: |
SERPINE1 |
Antibody Type: |
Monoclonal Antibody |
Application Verdünnung: |
ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol. |
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in a subset of squamous epithelial cells. |
|
Immunohistochemical staining of human placenta shows moderate cytoplasmic positivity in endothelial cells. |
|
Immunohistochemical staining of human urinary bladder shows moderate cytoplasmic positivity in a subset of urothelial cells. |
|
Immunohistochemical staining of human colon shows moderate to strong cytoplasmic positivity in endothelial cells. |
|
HPA050039 |
|
|
|
HPA050039 |
|
HPA050039 |