Anti-CD80, Rabbit, Polyclonal

Artikelnummer: ATA-HPA050092
Artikelname: Anti-CD80, Rabbit, Polyclonal
Artikelnummer: ATA-HPA050092
Hersteller Artikelnummer: HPA050092
Alternativnummer: ATA-HPA050092-25,ATA-HPA050092-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: B7-1, B7.1, CD28LG, CD28LG1, Pan-Cancer
CD80 molecule
Anti-CD80
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 941
UniProt: P33681
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: YECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD80
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human tonsil and pancreas tissues using Anti-CD80 antibody. Corresponding CD80 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
HPA050092
HPA050092
HPA050092