Anti-CD80, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA050092
- Bilder (6)
Artikelname: | Anti-CD80, Rabbit, Polyclonal |
Artikelnummer: | ATA-HPA050092 |
Hersteller Artikelnummer: | HPA050092 |
Alternativnummer: | ATA-HPA050092-25,ATA-HPA050092-100 |
Hersteller: | Atlas Antibodies |
Wirt: | Rabbit |
Kategorie: | Antikörper |
Applikation: | IHC |
Spezies Reaktivität: | Human |
Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Konjugation: | Unconjugated |
Alternative Synonym: | B7-1, B7.1, CD28LG, CD28LG1, Pan-Cancer |
CD80 molecule |
Anti-CD80 |
Klonalität: | Polyclonal |
Konzentration: | 0.1 mg/ml |
Isotyp: | IgG |
NCBI: | 941 |
UniProt: | P33681 |
Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
Sequenz: | YECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENG |
Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Target-Kategorie: | CD80 |
Antibody Type: | Monoclonal Antibody |
Application Verdünnung: | IHC: 1:50 - 1:200 |