Anti-IRAK2 Antibody 100ul, Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA050520
Artikelname: Anti-IRAK2 Antibody 100ul, Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA050520
Hersteller Artikelnummer: HPA050520
Alternativnummer: ATA-HPA050520-100,ATA-HPA050520-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IRAK2
interleukin-1 receptor-associated kinase 2

Anti-IRAK2

Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 3656
UniProt: O43187
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IRAK2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
HPA050520
HPA050520