Anti-LMNB1, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA050524
- Bilder (12)
| Artikelname: | Anti-LMNB1, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA050524 |
| Hersteller Artikelnummer: | HPA050524 |
| Alternativnummer: | ATA-HPA050524-25,ATA-HPA050524-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LMNB1 |
| lamin B1 |
| Anti-LMNB1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 4001 |
| UniProt: | P20700 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LMNB1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line MCF7 shows localization to nuclear membrane. |
|
|
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using HPA050524 antibody. Corresponding LMNB1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong positivity in nuclear membrane in non-germinal center cells. |
|
|
Immunohistochemical staining of human skin shows moderate to strong positivity in nuclear membrane in keratinocytes. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong positivity in nuclear membrane in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate to strong positivity in nuclear membrane in myocytes. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue |
|
|
HPA050524 |
|
|
|
|
|
|
|
|
HPA050524 |
|
|
HPA050524 |
Produktgarantie und fachkundiger Support
